PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM05G17550.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 315aa    MW: 34288.6 Da    PI: 4.544
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM05G17550.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1462e-45101381128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lp GfrFhPtdeelv +yL+++++g ++++  +i++v+iy+++Pw+Lp+++  +e+ewyfF+ rd++y+++ r++r+++sg+Wkatg+dk+v +
  OGLUM05G17550.1  10 LPTGFRFHPTDEELVINYLQRRATGLSCPI-PIIADVEIYNFNPWELPSMALFGEHEWYFFTLRDHRYPNSVRPSRSAASGFWKATGTDKPVQV 102
                      699***************************.88***************76667999************************************99 PP

              NAM  95 k..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +  +++ v +kk Lvfy gr p  +kt+W+mheyrl
  OGLUM05G17550.1 103 AnmQSTPVAMKKALVFYVGRPPMETKTTWIMHEYRL 138
                      8667777***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.28E-563173IPR003441NAC domain
PROSITE profilePS5100552.41910173IPR003441NAC domain
PfamPF023655.7E-2411138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MAMQLSLPVL PTGFRFHPTD EELVINYLQR RATGLSCPIP IIADVEIYNF NPWELPSMAL  60
FGEHEWYFFT LRDHRYPNSV RPSRSAASGF WKATGTDKPV QVANMQSTPV AMKKALVFYV  120
GRPPMETKTT WIMHEYRLTN TGGSTASHPS LSSSTAHPSV KLDEWVLCKI FNKSPEPDNT  180
APPSNVVSRL QCSPPLPPPA APPGNYPPLP VGATNDGGVF AGAGDMLFTI QEHQEGTPSM  240
LPPIPNLEPP AATIGNSSLN GTAAAAAAAA AAADDGHGRL EEEDTSAYTF TDQEMEQMLM  300
DLMDQDFFGN DQPQE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-5811734165NO APICAL MERISTEM PROTEIN
1ut4_B1e-5811734165NO APICAL MERISTEM PROTEIN
1ut7_A1e-5811734165NO APICAL MERISTEM PROTEIN
1ut7_B1e-5811734165NO APICAL MERISTEM PROTEIN
3ulx_A1e-581017615171Stress-induced transcription factor NAC1
4dul_A1e-5811734165NAC domain-containing protein 19
4dul_B1e-5811734165NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1073300.0AK107330.1 Oryza sativa Japonica Group cDNA clone:002-126-F03, full insert sequence.
GenBankEU8469990.0EU846999.1 Oryza sativa Japonica Group clone KCS021f05 NAM protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638459.10.0PREDICTED: NAC transcription factor 25
SwissprotQ8GY422e-69NAC25_ARATH; NAC transcription factor 25
TrEMBLA0A0D9ZZ760.0A0A0D9ZZ76_9ORYZ; Uncharacterized protein
STRINGORGLA05G0143100.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP162071212
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.11e-65NAC domain containing protein 25